PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_7B0E46392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 64aa    MW: 7951.03 Da    PI: 9.1898
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_7B0E46392.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR145.82e-141062153
                   FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerr 53
                           +fYn+YA e GFsvrk + +  + n++i+ r+fvCs+eg ree++ k+++e r
  Traes_3DL_7B0E46392.1 10 EFYNKYALEKGFSVRKGYVEWDEANEKIILRKFVCSREGCREEKHMKRKREDR 62
                           6******************************************9999444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.7E-121062IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
MFHSEDEGFE FYNKYALEKG FSVRKGYVEW DEANEKIILR KFVCSREGCR EEKHMKRKRE  60
DRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751141.14e-28PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010231784.21e-27PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5AIZ71e-35W5AIZ7_WHEAT; Uncharacterized protein
TrEMBLW5DB611e-39W5DB61_WHEAT; Uncharacterized protein
STRINGBRADI2G37795.14e-27(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2449976
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28530.12e-07FAR1-related sequence 10
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]